Structure of PDB 7ezx Chain vL

Receptor sequence

>7ezxvL (length=177) Species: 35688 (Porphyridium purpureum)

MLDAFSRVVVNSDAKAAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASC
MVSDAVSGMICENPGLISPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DASVLEDRCLNGLKETYIALGVPTNSSIRAVSIMKAQAVAFITNTATERK
MSFAAGDCTSLASEVASYFDRVGAAIS

3D structure

• PDB: 7ezx Structure of the phycobilisome from the red alga Porphyridium purpureum in Middle Light
• Chain: vL
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	vL	N35 K36 L38 D39 I142 F153 A154 A155 G156 C158	N35 K36 L38 D39 I142 F153 A154 A155 G156 C158
BS02	PEB	vL	N72 C73 R77 R78 A81 C82 R84 D85 L113 L120 V122 P123 S127	N72 C73 R77 R78 A81 C82 R84 D85 L113 L120 V122 P123 S127
BS03	PEB	vL	C50 D54 G58 C61 R129 I133 Q137 F141 T147 E148	C50 D54 G58 C61 R129 I133 Q137 F141 T147 E148

Gene Ontology

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0030089 phycobilisome

External links

• PDB: RCSB:7ezx, PDBe:7ezx, PDBj:7ezx
• PDBsum: 7ezx
• UniProt: P11393|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)