Structure of PDB 8v84 Chain v

Receptor sequence

>8v84v (length=149) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

SVRKRKMNRSSVGKATRRNKDKQRKINIQSNPIIAANWDYSLTMAQNYKK
LGLRAKLQTPAGGKEADLSKVVKRIPLTEVVKKLEELASRPVIRKERSQS
EREEEWLEKLYKKHGDDYKKMFFDKKLNIYQQSEGDLKRRLLRWKKRNG

3D structure

PDB

8v84 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	v	S3 R5 K6 R7 K16 A17 T18 R19 K22 K24 R26 N29 Q31 S32 P34 T45 Q48 A63 G64 G65 R172 R175 S176 S178 R180 E181 W184 Q210 S211 G213 K216 R217 R218 L220	S1 R3 K4 R5 K14 A15 T16 R17 K20 K22 R24 N27 Q29 S30 P32 T43 Q46 A61 G62 G63 R94 R97 S98 S100 R102 E103 W106 Q132 S133 G135 K138 R139 R140 L142
BS02	rna	v	R11 S12 S13 Q25	R9 S10 S11 Q23

Gene Ontology

	Molecular Function
GO:0003674	molecular_function
GO:0005515	protein binding

	Biological Process
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8v84, PDBe:8v84, PDBj:8v84
PDBsum	8v84
PubMed	38632236
UniProt	P40007\|NOP16_YEAST Nucleolar protein 16 (Gene Name=NOP16)

[Back to BioLiP]