Structure of PDB 8qbt Chain v

Receptor sequence
>8qbtv (length=96) Species: 679895 (Escherichia coli BW25113) [Search protein sequence]
AKQSMKAREVKRVALADKYFAKRAELKAIISDVNARWNAVLKLQTLPRDS
SPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
3D structure
PDB8qbt Novel arrest peptides induce ribosome stalling by short circuiting the ribosomal peptidyltransferase activity
Chainv
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna v A2 K3 Q4 S5 M6 R9 R13 Y20 D33 Q49 R53 S56 S58 R59 R61 N62 R63 T67 R69 H71 G72 L74 R75 R81 I82 R85 K98 S100 W101 A1 K2 Q3 S4 M5 R8 R12 Y19 D32 Q44 R48 S51 S53 R54 R56 N57 R58 T62 R64 H66 G67 L69 R70 R76 I77 R80 K93 S95 W96
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qbt, PDBe:8qbt, PDBj:8qbt
PDBsum8qbt
PubMed38503735
UniProtP0AG59|RS14_ECOLI Small ribosomal subunit protein uS14 (Gene Name=rpsN)

[Back to BioLiP]