Structure of PDB 8ev3 Chain v

Receptor sequence

>8ev3v (length=161) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]

ANPRQRNKQRSGKPRLTRRNANKKAKAKIYGNFVIQQNWDKHATLRQNYA
RLGLLATPNYVTGGVEKLYPDPTLDDVLDKEISIAPAKTEVVRQLEEEAV
KKAARQSNKMLPLSAFEHAYIQRLINKYGTEDFESMAKDVKLNSKLFNGS
KLKNLYIRMKA

3D structure

PDB

8ev3 Chromatin localization of nucleophosmin organizes ribosome biogenesis.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	v	A2 N3 R5 Q6 R7 K9 R16 L17 T18 R19 R20 K25 K29 I30 Y31 Q37 H43 T45 R47 Y61 T63 G64 G65 E67 K148 K155 S160 F162 E163 E180 K191 N194 S196 K197	A1 N2 R4 Q5 R6 K8 R15 L16 T17 R18 R19 K24 K28 I29 Y30 Q36 H42 T44 R46 Y60 T62 G63 G64 E66 K102 K109 S114 F116 E117 E134 K145 N148 S150 K151
BS02	rna	v	Q10 R11 S12 K24	Q9 R10 S11 K23

Gene Ontology

	Molecular Function
GO:0003674	molecular_function

	Biological Process
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis
GO:0042273	ribosomal large subunit biogenesis
GO:1902626	assembly of large subunit precursor of preribosome

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ev3, PDBe:8ev3, PDBj:8ev3
PDBsum	8ev3
PubMed	36423630
UniProt	Q9Y7Z1\|NOP16_SCHPO Nucleolar protein 16 (Gene Name=nop16)

[Back to BioLiP]