Structure of PDB 8esr Chain v

Receptor sequence

>8esrv (length=161) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]

ANPRQRNKQRSGKPRLTRRNANKKAKAKIYGNFVIQQNWDKHATLRQNYA
RLGLLATPNYVTGGVEKLYPDPTLDDVLDKEISIAPAKTEVVRQLEEEAV
KKAARQSNKMLPLSAFEHAYIQRLINKYGTEDFESMAKDVKLNSKLFNGS
KLKNLYIRMKA

3D structure

PDB

8esr Chromatin localization of nucleophosmin organizes ribosome biogenesis.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	v	A2 N3 R5 Q6 R7 K9 R11 R16 L17 T18 R19 R20 K25 K29 I30 Q37 K42 H43 T45 R47 Y61 T63 G64 G65 E67 K155 S160 F162 E163 K191 N194 S196	A1 N2 R4 Q5 R6 K8 R10 R15 L16 T17 R18 R19 K24 K28 I29 Q36 K41 H42 T44 R46 Y60 T62 G63 G64 E66 K109 S114 F116 E117 K145 N148 S150
BS02	rna	v	Q10 R11 S12 K14 P15 K24	Q9 R10 S11 K13 P14 K23

Gene Ontology

	Molecular Function
GO:0003674	molecular_function

	Biological Process
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis
GO:0042273	ribosomal large subunit biogenesis
GO:1902626	assembly of large subunit precursor of preribosome

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8esr, PDBe:8esr, PDBj:8esr
PDBsum	8esr
PubMed	36423630
UniProt	Q9Y7Z1\|NOP16_SCHPO Nucleolar protein 16 (Gene Name=nop16)

[Back to BioLiP]