Structure of PDB 8aaf Chain v

Receptor sequence
>8aafv (length=142) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIF
TGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKA
PEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD
3D structure
PDB8aaf Molecular basis of eIF5A-dependent CAT tailing in eukaryotic ribosome-associated quality control.
Chainv
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna v T49 G50 X51 H52 H54 K56 K69 E71 L73 T34 G35 X36 H37 H39 K41 K54 E56 L58
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0003746 translation elongation factor activity
GO:0005515 protein binding
GO:0043022 ribosome binding
Biological Process
GO:0002182 cytoplasmic translational elongation
GO:0002184 cytoplasmic translational termination
GO:0006412 translation
GO:0006413 translational initiation
GO:0006414 translational elongation
GO:0006452 translational frameshifting
GO:0045901 positive regulation of translational elongation
GO:0045905 positive regulation of translational termination
GO:0045948 positive regulation of translational initiation
GO:0072344 rescue of stalled ribosome
GO:0097622 cytoplasmic translational elongation through polyproline stretches
GO:0140708 CAT tailing
GO:1903272 positive regulation of cytoplasmic translational elongation through polyproline stretches
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8aaf, PDBe:8aaf, PDBj:8aaf
PDBsum8aaf
PubMed36804914
UniProtP23301|IF5A1_YEAST Eukaryotic translation initiation factor 5A-1 (Gene Name=HYP2)

[Back to BioLiP]