Structure of PDB 7piq Chain v

Receptor sequence
>7piqv (length=63) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
AKKDQLTLRGPLYGNNRSHSKTITRRKWNVNLQPCKVKTADGKTTRILVS
TRTLRTLKKHNRL
3D structure
PDB7piq Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chainv
Resolution9.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna v A2 K3 R10 P12 L13 Y14 N16 R18 H20 S21 K22 T23 R26 K28 W29 N30 V31 N32 L33 Q34 C36 K37 D42 T46 R47 T52 R53 R56 K60 H61 A1 K2 R9 P11 L12 Y13 N15 R17 H19 S20 K21 T22 R25 K27 W28 N29 V30 N31 L32 Q33 C35 K36 D41 T45 R46 T51 R52 R55 K59 H60
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7piq, PDBe:7piq, PDBj:7piq
PDBsum7piq
PubMed36171285
UniProtP75171|RL28_MYCPN Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]