Structure of PDB 7pip Chain v

Receptor sequence
>7pipv (length=63) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
AKKDQLTLRGPLYGNNRSHSKTITRRKWNVNLQPCKVKTADGKTTRILVS
TRTLRTLKKHNRL
3D structure
PDB7pip Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chainv
Resolution9.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna v A2 K3 L13 Y14 N16 N17 R18 S19 H20 S21 T23 R26 R27 K28 W29 N30 V31 N32 K37 R47 R53 R56 T57 K60 H61 A1 K2 L12 Y13 N15 N16 R17 S18 H19 S20 T22 R25 R26 K27 W28 N29 V30 N31 K36 R46 R52 R55 T56 K59 H60
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pip, PDBe:7pip, PDBj:7pip
PDBsum7pip
PubMed36171285
UniProtP75171|RL28_MYCPN Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]