Structure of PDB 7phc Chain v

Receptor sequence

>7phcv (length=63) Species: 272634 (Mycoplasmoides pneumoniae M129)

AKKDQLTLRGPLYGNNRSHSKTITRRKWNVNLQPCKVKTADGKTTRILVS
TRTLRTLKKHNRL

3D structure

• PDB: 7phc Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: v
• Resolution: 9.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	v	A2 K3 K4 R10 P12 L13 Y14 N17 R18 S19 H20 S21 K22 T23 I24 R26 R27 W29 N30 V31 N32 Q34 P35 K37 D42 K44 R47 T52 R53 R56 K60 H61	A1 K2 K3 R9 P11 L12 Y13 N16 R17 S18 H19 S20 K21 T22 I23 R25 R26 W28 N29 V30 N31 Q33 P34 K36 D41 K43 R46 T51 R52 R55 K59 H60
BS02	rna	v	H20 S21 K22	H19 S20 K21

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7phc, PDBe:7phc, PDBj:7phc
• PDBsum: 7phc
• PubMed: 36171285
• UniProt: P75171|RL28_MYCPN Large ribosomal subunit protein bL28 (Gene Name=rpmB)