Structure of PDB 7oht Chain v

Receptor sequence
>7ohtv (length=263) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
NARAKRALVKREAKLVENVKQALFIPGQSCNKNLHDIMVDLSALKKPDMK
RFNRKNDIHPFEDMSPLEFFSEKNDCSLMVLMTSSKKRKNNMTFIRTFGY
KIYDMIELMVADNFKLLSDFKKLTFTVGLKPMFTFQGAAFDTHPVYKQIK
SLFLDFFRGESTDLQDVAGLQHVISMTIQGDFQDGEPLPNVLFRVYKLKS
YKSDQGGKRLPRIELVEIGPRLDFKIGRIHTPSPDMVTEAHKKPKQKKNV
ELDIMGDKLGRIH
3D structure
PDB7oht Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
Chainv
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna v N9 R11 R14 F60 N61 R62 F77 F78 K81 N82 K253 N1 R3 R6 F52 N53 R54 F69 F70 K73 N74 K245
BS02 rna v Q36 N39 K54 R59 E70 S93 K94 K95 R96 R236 Q28 N31 K46 R51 E62 S85 K86 K87 R88 R228
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0008312 7S RNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000470 maturation of LSU-rRNA
GO:0006364 rRNA processing
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oht, PDBe:7oht, PDBj:7oht
PDBsum7oht
PubMed34813592
UniProtP36160|RPF2_YEAST Ribosome biogenesis protein RPF2 (Gene Name=RPF2)

[Back to BioLiP]