Structure of PDB 7oh3 Chain v

Receptor sequence

>7oh3v (length=287) Species: 559292 (Saccharomyces cerevisiae S288C)

NARAKRALVKREAKLVENVKQALFIPGQSCNKNLHDIMVDLSALKKPDMK
RFNRKNDIHPFEDMSPLEFFSEKNDCSLMVLMTSSKKRKNNMTFIRTFGY
KIYDMIELMVADNFKLLSDFKKLTFTVGLKPMFTFQGAAFDTHPVYKQIK
SLFLDFFRGESTDLQDVAGLQHVISMTIQGDFQDGEPLPNVLFRVYKLKS
YKSDQGGKRLPRIELVEIGPRLDFKIGRIHTPSPDMVTEAHKKPKQKKNV
ELDIMGDKLGRIHMGKQDLGKLQTRKMKGLKSKFDQG

3D structure

• PDB: 7oh3 Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
• Chain: v
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	v	N9 R11 A12 R14 L16 K18 N61 R62 F77 K81 N82 Q254 K261 N262 H276 M277 K279 Q280 L282 Q286 T287 R288 K289 L293	N1 R3 A4 R6 L8 K10 N53 R54 F69 K73 N74 Q246 K248 N249 H263 M264 K266 Q267 L269 Q273 T274 R275 K276 L280
BS02	rna	v	N39 K40 H43 R59 E70 K94 K95 R96 R236	N31 K32 H35 R51 E62 K86 K87 R88 R228

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008097 5S rRNA binding
• GO:0008312 7S RNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000470 maturation of LSU-rRNA
• GO:0006364 rRNA processing
• GO:1902626 assembly of large subunit precursor of preribosome

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0030687 preribosome, large subunit precursor

External links

• PDB: RCSB:7oh3, PDBe:7oh3, PDBj:7oh3
• PDBsum: 7oh3
• PubMed: 34813592
• UniProt: P36160|RPF2_YEAST Ribosome biogenesis protein RPF2 (Gene Name=RPF2)