Structure of PDB 7bt6 Chain v

Receptor sequence
>7bt6v (length=287) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
NARAKRALVKREAKLVENVKQALFIPGQSCNKNLHDIMVDLSALKKPDMK
RFNRKNDIHPFEDMSPLEFFSEKNDCSLMVLMTSSKKRKNNMTFIRTFGY
KIYDMIELMVADNFKLLSDFKKLTFTVGLKPMFTFQGAAFDTHPVYKQIK
SLFLDFFRGESTDLQDVAGLQHVISMTIQGDFQDGEPLPNVLFRVYKLKS
YKSDQGGKRLPRIELVEIGPRLDFKIGRIHTPSPDMVTEAHKKPKQKKNV
ELDIMGDKLGRIHMGKQDLGKLQTRKMKGLKSKFDQG
3D structure
PDB7bt6 Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
Chainv
Resolution3.12 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna v N9 R11 A12 R14 F60 R62 K81 S241 P242 K250 K253 Q254 K261 N262 H276 K279 Q280 L282 Q286 T287 K289 L293 K296 N1 R3 A4 R6 F52 R54 K73 S233 P234 K242 K245 Q246 K248 N249 H263 K266 Q267 L269 Q273 T274 K276 L280 K283
BS02 rna v N39 K40 K94 R96 N31 K32 K86 R88
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0008312 7S RNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000470 maturation of LSU-rRNA
GO:0006364 rRNA processing
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7bt6, PDBe:7bt6, PDBj:7bt6
PDBsum7bt6
PubMed33037216
UniProtP36160|RPF2_YEAST Ribosome biogenesis protein RPF2 (Gene Name=RPF2)

[Back to BioLiP]