Structure of PDB 6w1o Chain v

Receptor sequence
>6w1ov (length=137) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNP
SLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADI
FPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
3D structure
PDB6w1o Untangling the sequence of events during the S2→ S3transition in photosystem II and implications for the water oxidation mechanism.
Chainv
Resolution2.08 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC v A36 C37 C40 H41 T46 D53 L54 L59 Y75 M76 Y82 H92 P93 M104 A36 C37 C40 H41 T46 D53 L54 L59 Y75 M76 Y82 H92 P93 M104
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
Biological Process
GO:0015979 photosynthesis
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0009523 photosystem II
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w1o, PDBe:6w1o, PDBj:6w1o
PDBsum6w1o
PubMed32434915
UniProtP0A386|CY550_THEVB Photosystem II extrinsic protein V (Gene Name=psbV)

[Back to BioLiP]