Structure of PDB 6s13 Chain v

Receptor sequence

>6s13v (length=162) Species: 1280 (Staphylococcus aureus) [Search protein sequence]

IRFEIHGDNLTITDAIRNYIEEKIGKLERYFNDVPNAVAHVKVKTYSNSA
TKIEVTIPLKNVTLRAEERNDDLYAGIDLINNKLERQVRKYKTRINRKSR
DRGDQIEIIRSKEFSLKPMDSEEAVLQMNLLGHDFFVFTDRETDGTSIVY
RRKDGKYGLIQT

3D structure

PDB

6s13 Exit tunnel modulation as resistance mechanism of S. aureus erythromycin resistant mutant.

Chain

Resolution

3.58 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	v	I2 R3 F4 E5 I6 H7 G8 D9 N10 L28 E29 R30 Y31 F32 N33 D34 V35 P36 H41 K45 T46 Y47 S48 K53 E69 Y75 L80 N83 K84 R87 Q88 R90 K91 Y92 R95 N97 R98 K99 S100 R101 D102	I1 R2 F3 E4 I5 H6 G7 D8 N9 L27 E28 R29 Y30 F31 N32 D33 V34 P35 H40 K44 T45 Y46 S47 K52 E68 Y74 L79 N82 K83 R86 Q87 R89 K90 Y91 R94 N96 R97 K98 S99 R100 D101

Gene Ontology

	Biological Process
GO:0044238	primary metabolic process

View graph for
Biological Process

External links

PDB	RCSB:6s13, PDBe:6s13, PDBj:6s13
PDBsum	6s13
PubMed	31391518
UniProt	D2Z097

[Back to BioLiP]