Structure of PDB 6ri5 Chain v

Receptor sequence
>6ri5v (length=60) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIA
WTVLFRKHHK
3D structure
PDB6ri5 Mechanism of completion of peptidyltransferase centre assembly in eukaryotes.
Chainv
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna v G16 R17 S34 K35 Q42 R43 K44 R48 I49 W51 R56 G16 R17 S34 K35 Q42 R43 K44 R48 I49 W51 R56
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006413 translational initiation
GO:0006414 translational elongation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ri5, PDBe:6ri5, PDBj:6ri5
PDBsum6ri5
PubMed31115337
UniProtP04449|RL24A_YEAST Large ribosomal subunit protein eL24A (Gene Name=RPL24A)

[Back to BioLiP]