Structure of PDB 6n8o Chain v

Receptor sequence
>6n8ov (length=98) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
VKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSP
YERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH
3D structure
PDB6n8o Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
Chainv
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna v K13 V17 K25 I26 S27 Y28 K29 K30 G31 A33 S34 N35 R36 R41 Y53 R68 R76 G78 R82 K84 K11 V15 K23 I24 S25 Y26 K27 K28 G29 A31 S32 N33 R34 R39 Y51 R66 R74 G76 R80 K82
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n8o, PDBe:6n8o, PDBj:6n8o
PDBsum6n8o
PubMed30814529
UniProtP05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)

[Back to BioLiP]