Structure of PDB 6ft6 Chain v

Receptor sequence
>6ft6v (length=287) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
NARAKRALVKREAKLVENVKQALFIPGQSCNKNLHDIMVDLSALKKPDMK
RFNRKNDIHPFEDMSPLEFFSEKNDCSLMVLMTSSKKRKNNMTFIRTFGY
KIYDMIELMVADNFKLLSDFKKLTFTVGLKPMFTFQGAAFDTHPVYKQIK
SLFLDFFRGESTDLQDVAGLQHVISMTIQGDFQDGEPLPNVLFRVYKLKS
YKSDQGGKRLPRIELVEIGPRLDFKIGRIHTPSPDMVTEAHKKPKQKKNV
ELDIMGDKLGRIHMGKQDLGKLQTRKMKGLKSKFDQG
3D structure
PDB6ft6 Structure of the nuclear exosome captured on a maturing preribosome.
Chainv
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna v N9 R11 A12 R14 L16 R62 F77 K81 N82 Q254 K261 H276 M277 Q280 D281 L282 Q286 T287 R288 K289 L293 N1 R3 A4 R6 L8 R54 F69 K73 N74 Q246 K248 H263 M264 Q267 D268 L269 Q273 T274 R275 K276 L280
BS02 rna v N39 V47 K94 K95 R96 N31 V39 K86 K87 R88
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0008312 7S RNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000470 maturation of LSU-rRNA
GO:0006364 rRNA processing
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ft6, PDBe:6ft6, PDBj:6ft6
PDBsum6ft6
PubMed29519915
UniProtP36160|RPF2_YEAST Ribosome biogenesis protein RPF2 (Gene Name=RPF2)

[Back to BioLiP]