Structure of PDB 5yzg Chain v

Receptor sequence
>5yzgv (length=144) Species: 9606 (Homo sapiens) [Search protein sequence]
SDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYV
HKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTS
KIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI
3D structure
PDB5yzg Structure of a human catalytic step I spliceosome
Chainv
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide v H15 K18 F19 K43 V85 H11 K14 F15 K39 V81
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0006406 mRNA export from nucleus
GO:0008380 RNA splicing
GO:0050684 regulation of mRNA processing
GO:0051028 mRNA transport
GO:2000622 regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005829 cytosol
GO:0035145 exon-exon junction complex
GO:0043025 neuronal cell body
GO:0071005 U2-type precatalytic spliceosome
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:1990501 exon-exon junction subcomplex mago-y14

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5yzg, PDBe:5yzg, PDBj:5yzg
PDBsum5yzg
PubMed29301961
UniProtQ96A72|MGN2_HUMAN Protein mago nashi homolog 2 (Gene Name=MAGOHB)

[Back to BioLiP]