Structure of PDB 5mmj Chain v |
>5mmjv (length=80) Species: 3562 (Spinacia oleracea) [Search protein sequence] |
ESPYKVYIGNLAKTVTNELLKDFFSEKGKVLGAKVQRTPGTSKSNGFGFV SFSSEEEVEAAIQALNNSVLEGQKIRVNKA |
|
PDB | 5mmj The complete structure of the chloroplast 70S ribosome in complex with translation factor pY. |
Chain | v |
Resolution | 3.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
v |
Y187 R256 N258 |
Y7 R76 N78 |
|
|
|
|