Structure of PDB 2axt Chain v

Receptor sequence

>2axtv (length=137) Species: 146786 (Thermosynechococcus vestitus)

AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNP
SLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADI
FPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY

3D structure

• PDB: 2axt Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
• Chain: v
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	v	A5062 C5063 C5066 H5067 L5078 D5079 L5080 L5085 Y5101 M5102 Y5108 H5118 P5119	A36 C37 C40 H41 L52 D53 L54 L59 Y75 M76 Y82 H92 P93

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis
• GO:0018063 cytochrome c-heme linkage
• GO:0019684 photosynthesis, light reaction
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0009523 photosystem II
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:2axt, PDBe:2axt, PDBj:2axt
• PDBsum: 2axt
• PubMed: 16355230
• UniProt: P0A386|CY550_THEVB Photosystem II extrinsic protein V (Gene Name=psbV)