Structure of PDB 7osm Chain uL5

Receptor sequence

>7osmuL5 (length=169) Species: 4932 (Saccharomyces cerevisiae)

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

3D structure

• PDB: 7osm Accuracy mechanism of eukaryotic ribosome translocation.
• Chain: uL5
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	uL5	K16 V18 N20 S22 S48 Y52 V54 F57 A66 H68 R94 N95 F96 S97 T99 N101 G103 F104 G105 I106 G124 M125 D126 F127 Y128 K142	K11 V13 N15 S17 S43 Y47 V49 F52 A61 H63 R89 N90 F91 S92 T94 N96 G98 F99 G100 I101 G119 M120 D121 F122 Y123 K137
BS02	rna	uL5	P8 M9 Q43 T44 V46 V69 T70 R72 G135 R137 R140 R141 G149 N150 S151 H152	P3 M4 Q38 T39 V41 V64 T65 R67 G130 R132 R135 R136 G144 N145 S146 H147
BS03	rna	uL5	Y52 T53 V54 R55 R61	Y47 T48 V49 R50 R56

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 17:43:41 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7osm', asym_id = 'uL5', title = 'Accuracy mechanism of eukaryotic ribosome translocation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7osm', asym_id='uL5', title='Accuracy mechanism of eukaryotic ribosome translocation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7osm', asym_id = 'uL5'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7osm', asym_id='uL5')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>