Structure of PDB 8b2l Chain u3

Receptor sequence

>8b2lu3 (length=191) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

MKTILSSETMDIPDGVNIKVKAKQIEVEGPRGKLTRNFKHLNLDFQLIKD
EETGKKKLKIDAWFGSRKTTAAIRTALSHVENLITGVTKGYRYKMRFVYA
HFPINASISGGNKAIEIRNFLGEKRVRKVDMLEGVTVVRSEKVKDELVLD
GNDIELVSRSAALINQKCHVKNKDIRKFLDGIYVSEKGRIV

3D structure

PDB

8b2l Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	u3	K23 H40 N42 L43 D44 W63 R67 K68 A71 R74 T75 S78 H79 N82 H101 F102 E123 K124 R125 S158 R159 Q166 K171 K173 D174 R176 K177 F178	K23 H40 N42 L43 D44 W63 R67 K68 A71 R74 T75 S78 H79 N82 H101 F102 E123 K124 R125 S158 R159 Q166 K171 K173 D174 R176 K177 F178

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8b2l, PDBe:8b2l, PDBj:8b2l
PDBsum	8b2l
PubMed	37156858
UniProt	A0A1S4C068

[Back to BioLiP]