Structure of PDB 7nwg Chain u3

Receptor sequence
>7nwgu3 (length=153) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
EIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRI
TVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDE
IVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSG
AVE
3D structure
PDB7nwg Blasticidin S inhibits mammalian translation and enhances production of protein encoded by nonsense mRNA.
Chainu3
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna u3 R16 E21 L56 R57 S76 S78 I82 R90 K94 N97 I98 K99 H100 R119 L121 K130 G134 T135 Q137 S138 V139 G140 R146 H147 P148 R8 E13 L48 R49 S68 S70 I74 R82 K86 N89 I90 K91 H92 R111 L113 K122 G126 T127 Q129 S130 V131 G132 R138 H139 P140
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 14:03:24 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7nwg', asym_id = 'u3', title = 'Blasticidin S inhibits mammalian translation and...s production of protein encoded by nonsense mRNA.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7nwg', asym_id='u3', title='Blasticidin S inhibits mammalian translation and...s production of protein encoded by nonsense mRNA.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7nwg', asym_id = 'u3'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7nwg', asym_id='u3')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>