Structure of PDB 8fxr Chain u2 |
>8fxru2 (length=136) Species: 2557550 (Agrobacterium phage Milano) [Search protein sequence] |
MNFNVGVDFPSFIAWDGEESFPVKVDGFNQFGFTFKTIAALTAATTFNIF YHEPSDADPCVPGPAIRVPEVPFCDTVLLSEDGLAAVTLPETVTPDSFCA GTVPCMNGQWISIAPATGSETNAANVQITVTMKGAT |
|
PDB | 8fxr Neck and capsid architecture of the robust Agrobacterium phage Milano. |
Chain | u2 |
Resolution | 4.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
u2 |
N4 C60 |
N4 C60 |
|
|
|