Structure of PDB 8qsj Chain u

Receptor sequence
>8qsju (length=126) Species: 9606 (Homo sapiens) [Search protein sequence]
KFDIDMMVSLLRQENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAF
YVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYEL
EKLWTLRSYDDQLAQIAPETVPEDFI
3D structure
PDB8qsj Structural insights into the role of GTPBP10 in the RNA maturation of the mitoribosome.
Chainu
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna u F140 K144 K147 H156 F50 K54 K57 H66
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0043023 ribosomal large subunit binding
GO:0140978 mitochondrial large ribosomal subunit binding
Biological Process
GO:0017148 negative regulation of translation
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
GO:0070130 negative regulation of mitochondrial translation
GO:0090071 negative regulation of ribosome biogenesis
Cellular Component
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qsj, PDBe:8qsj, PDBj:8qsj
PDBsum8qsj
PubMed38042949
UniProtQ96EH3|MASU1_HUMAN Mitochondrial assembly of ribosomal large subunit protein 1 (Gene Name=MALSU1)

[Back to BioLiP]