Structure of PDB 8oeq Chain u

Receptor sequence
>8oequ (length=130) Species: 5476 (Candida albicans) [Search protein sequence]
SSTVKAANWRFVEVGRVVLVDNKELATIVEIIDQKRVLIDGPKIQRQAIA
LAKIVLTPIVLPNLPRGSRTATVTKKWAAADIDAKWAASGWAKKLANKER
RSQLSDFERFQVMVLKKQRRFATKKALVKA
3D structure
PDB8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
Chainu
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna u N9 W10 R11 K36 K54 P66 R67 G68 R70 T71 A72 T73 K76 K77 G91 W92 K99 R102 S103 M114 K118 Q119 R121 F122 K125 K126 V129 N8 W9 R10 K35 K53 P65 R66 G67 R69 T70 A71 T72 K75 K76 G90 W91 K98 R101 S102 M113 K117 Q118 R120 F121 K124 K125 V128
BS02 MG u F12 E14 F11 E13
External links