Structure of PDB 8ipy Chain u

Receptor sequence

>8ipyu (length=67) Species: 9606 (Homo sapiens)

MKRPKLKKASKRMTCHKRYKIQKKVREHHRKLRKEAKKDPGVPNSAPFKE
ALLREAELRKQRLEELK

3D structure

• PDB: 8ipy Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
• Chain: u
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	u	M1 K2 R3 K5 L6 K7 S10 K11 R12 M13 T14 C15 K17 K20 I21 Q22 K24 V25 R26 H28 R30 R33 A54	M1 K2 R3 K5 L6 K7 S10 K11 R12 M13 T14 C15 K17 K20 I21 Q22 K24 V25 R26 H28 R30 R33 A46

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0048027 mRNA 5'-UTR binding

Biological Process

• GO:0017145 stem cell division
• GO:0019827 stem cell population maintenance
• GO:0032206 positive regulation of telomere maintenance
• GO:0033235 positive regulation of protein sumoylation
• GO:0042127 regulation of cell population proliferation
• GO:1902895 positive regulation of miRNA transcription
• GO:1904816 positive regulation of protein localization to chromosome, telomeric region

Cellular Component

• GO:0005615 extracellular space
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0005730 nucleolus
• GO:0016020 membrane
• GO:0016604 nuclear body
• GO:0030496 midbody

External links

• PDB: RCSB:8ipy, PDBe:8ipy, PDBj:8ipy
• PDBsum: 8ipy
• PubMed: 37491604
• UniProt: Q9BVP2|GNL3_HUMAN Guanine nucleotide-binding protein-like 3 (Gene Name=GNL3)