Structure of PDB 8eug Chain u

Receptor sequence
>8eugu (length=59) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]
RVHTCYFCSGPVYPGHGIMFVRNDSKVFRFCRSKCHKNFKMKRNPRKVAW
TKAYRKAHG
3D structure
PDB8eug Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Chainu
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna u G16 I19 R33 S34 K35 K38 R44 K48 A50 W51 R56 G15 I18 R32 S33 K34 K37 R43 K47 A49 W50 R55
Gene Ontology
Molecular Function
GO:0003674 molecular_function
Biological Process
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eug, PDBe:8eug, PDBj:8eug
PDBsum8eug
PubMed36423630
UniProtQ10353|RLP24_SCHPO Ribosome biogenesis protein rlp24 (Gene Name=rlp24)

[Back to BioLiP]