Structure of PDB 7v08 Chain u

Receptor sequence
>7v08u (length=150) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLK
WTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIR
QKRERAFYKNRMRGNKEKDFLRDKKLVESNPELLRIREVEIARKLAKEQE
3D structure
PDB7v08 rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
Chainu
Resolution2.36 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna u G16 G18 S34 K35 K38 Q42 R44 K50 W51 K53 R56 K61 R111 M112 N115 G16 G18 S34 K35 K38 Q42 R44 K50 W51 K53 R56 K61 R111 M112 N115
BS02 ZN u C6 C36 C6 C36
Gene Ontology
Molecular Function
GO:0001671 ATPase activator activity
GO:0051117 ATPase binding
Biological Process
GO:0032781 positive regulation of ATP-dependent activity
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7v08, PDBe:7v08, PDBj:7v08
PDBsum7v08
PubMed36864048
UniProtQ07915|RLP24_YEAST Ribosome biogenesis protein RLP24 (Gene Name=RLP24)

[Back to BioLiP]