Structure of PDB 7uqb Chain u

Receptor sequence
>7uqbu (length=150) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLK
WTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIR
QKRERAFYKNRMRGNKEKDFLRDKKLVESNPELLRIREVEIARKLAKEQE
3D structure
PDB7uqb rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
Chainu
Resolution2.43 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna u G16 G18 S34 K35 K38 Q42 K50 W51 K53 R56 K61 R111 M112 N115 G16 G18 S34 K35 K38 Q42 K50 W51 K53 R56 K61 R111 M112 N115
BS02 ZN u C6 C36 C6 C36
Gene Ontology
Molecular Function
GO:0001671 ATPase activator activity
GO:0051117 ATPase binding
Biological Process
GO:0032781 positive regulation of ATP-dependent activity
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uqb, PDBe:7uqb, PDBj:7uqb
PDBsum7uqb
PubMed36864048
UniProtQ07915|RLP24_YEAST Ribosome biogenesis protein RLP24 (Gene Name=RLP24)

[Back to BioLiP]