Structure of PDB 7phb Chain u

Receptor sequence
>7phbu (length=86) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
SKKGVGSTKNGRDSHAKRLGAKKADGQMIRTGQIIYRQRGTRVYPGVNVG
LGSDDTLFALSDGLVKYQKFGPKQGKTRVSVVKHKL
3D structure
PDB7phb Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chainu
Resolution4.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna u S17 K18 N26 R28 S30 H31 K33 R34 L35 K38 D41 G42 Q43 R46 G48 Q49 I50 R55 T57 R58 S69 D70 D71 F74 Y83 K85 S1 K2 N10 R12 S14 H15 K17 R18 L19 K22 D25 G26 Q27 R30 G32 Q33 I34 R39 T41 R42 S53 D54 D55 F58 Y67 K69
BS02 rna u G87 P88 G71 P72
BS03 rna u S17 K19 S1 K3
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7phb, PDBe:7phb, PDBj:7phb
PDBsum7phb
PubMed36171285
UniProtP75458|RL27_MYCPN Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]