Structure of PDB 7oii Chain u

Receptor sequence

>7oiiu (length=80) Species: 562 (Escherichia coli)

KIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNEC
GIGDVVEIRECRPLSKTKSWTLVRVVEKAV

3D structure

• PDB: 7oii A switch from alpha-helical to beta-strand conformation during co-translational protein folding.
• Chain: u
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	u	R6 S14 K16 M17 E18 K19 R27 Y34 R40 T41 T42 K43 L44 H45 E63 R65 P66 L67 S68 K69 T70 K71	R3 S11 K13 M14 E15 K16 R24 Y31 R37 T38 T39 K40 L41 H42 E60 R62 P63 L64 S65 K66 T67 K68

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 17 23:32:20 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7oii', asym_id = 'u', title = 'A switch from alpha-helical to beta-strand conformation during co-translational protein folding.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7oii', asym_id='u', title='A switch from alpha-helical to beta-strand conformation during co-translational protein folding.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7oii', asym_id = 'u'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7oii', asym_id='u')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>