Structure of PDB 7of3 Chain u

Receptor sequence

>7of3u (length=111) Species: 9606 (Homo sapiens)

KFDIDMMVSLLRQENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAF
YVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYEL
EKLWTLRSYDD

3D structure

• PDB: 7of3 Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
• Chain: u
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	u	K144 K147 H156	K54 K57 H66

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0043023 ribosomal large subunit binding
• GO:0140978 mitochondrial large ribosomal subunit binding

Biological Process

• GO:0017148 negative regulation of translation
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis
• GO:0070130 negative regulation of mitochondrial translation
• GO:0090071 negative regulation of ribosome biogenesis

Cellular Component

• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix
• GO:0005829 cytosol

External links

• PDB: RCSB:7of3, PDBe:7of3, PDBj:7of3
• PDBsum: 7of3
• PubMed: 34135319
• UniProt: Q96EH3|MASU1_HUMAN Mitochondrial assembly of ribosomal large subunit protein 1 (Gene Name=MALSU1)