Structure of PDB 6gqb Chain u

Receptor sequence

>6gqbu (length=260) Species: 559292 (Saccharomyces cerevisiae S288C)

ARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNR
LKYALNGREVKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENFRL
VYDVKGRFAVHRITDEEASYKLGKVKKVQLGKKGVPYVVTHDGRTIRYPD
PNIKVNDTVKIDLASGKITDFIKFDAGKLVYVTGGRNLGRIGTIVHKERH
DGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLPKGKGIKLSIAEE
RDRRRAQQGL

3D structure

• PDB: 6gqb Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.
• Chain: u
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	u	R3 P5 K6 K7 H8 K10 L12 L19 D21 K22 L23 C26 Y27 A28 P29 A33 G34 P35 H36 K37 L38 R39 R49 R51 N57 G58 R59 M66 R108 K128 Q130 L131 G132 K133 K134 G135 Y138 V140 T146 R148 R187 H197 K198 R200 G203 R221 I248 Q258	R2 P4 K5 K6 H7 K9 L11 L18 D20 K21 L22 C25 Y26 A27 P28 A32 G33 P34 H35 K36 L37 R38 R48 R50 N56 G57 R58 M65 R107 K127 Q129 L130 G131 K132 K133 G134 Y137 V139 T145 R147 R186 H196 K197 R199 G202 R220 I247 Q257

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:0032991 protein-containing complex
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gqb, PDBe:6gqb, PDBj:6gqb
• PDBsum: 6gqb
• PubMed: 29886014
• UniProt: P0CX35|RS4A_YEAST Small ribosomal subunit protein eS4A (Gene Name=RPS4A)