Structure of PDB 6fec Chain u |
>6fecu (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] |
YTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFE DLDSLLSALSLNEESLGNRRIRVDVA |
|
PDB | 6fec Structure of a human cap-dependent 48S translation pre-initiation complex. |
Chain | u |
Resolution | 6.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
u |
P32 R40 K42 |
P32 R40 K42 |
|
|
|
|