Structure of PDB 4d5y Chain u

Receptor sequence

>4d5yu (length=210) Species: 9986 (Oryctolagus cuniculus)

ADQEIENAVSRALEDAPERNFRETVDLAVNLRDLDLNDPSNRVDESVVLP
AGTGQETTIVVFAEGETALRAEEVADDVLDEDELEELGGDDDAAKDLADD
TDFFIAEKGLMQDIGRYLGTVLGPRGKMPEPLDPDDDVVEVIERMKNTVQ
LRSGERRTFHTRVGAEDMSAENIADNIDVILRRLHADLEKGPLNIDTVYV
KTTMGPAMEV

3D structure

• PDB: 4d5y Cryo-Em Structures of Ribosomal 80S Complexes with Termination Factors and Cricket Paralysis Virus Ires Reveal the Ires in the Translocated State
• Chain: u
• Resolution: 9.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	u	A28 V29 N30 L31 R32 L34 D91 D92 K95 T120 P124 R125 R152 G154 E155 R156 R157 T158 F159 H160 T197 Y199 K201	A28 V29 N30 L31 R32 L34 D91 D92 K95 T120 P124 R125 R152 G154 E155 R156 R157 T158 F159 H160 T197 Y199 K201

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Mar 3 04:56:07 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4d5y', asym_id = 'u', title = 'Cryo-Em Structures of Ribosomal 80S Complexes wi...s Ires Reveal the Ires in the Translocated State '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4d5y', asym_id='u', title='Cryo-Em Structures of Ribosomal 80S Complexes wi...s Ires Reveal the Ires in the Translocated State ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0006412,0015934', uniprot = '', pdbid = '4d5y', asym_id = 'u'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0006412,0015934', uniprot='', pdbid='4d5y', asym_id='u')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>