Structure of PDB 7og4 Chain t1

Receptor sequence
>7og4t1 (length=46) Species: 9606 (Homo sapiens) [Search protein sequence]
EALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLK
3D structure
PDB7og4 Structural basis of mitochondrial translation.
Chaint1
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide t1 T14 L15 T30 L31
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006390 mitochondrial transcription
GO:0006412 translation
GO:0032543 mitochondrial translation
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005759 mitochondrial matrix
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7og4, PDBe:7og4, PDBj:7og4
PDBsum7og4
PubMed32812867
UniProtP52815|RM12_HUMAN Large ribosomal subunit protein bL12m (Gene Name=MRPL12)

[Back to BioLiP]