Structure of PDB 8v84 Chain t

Receptor sequence
>8v84t (length=249) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
NKFVRAESIVAKTLATSREKERIKRVSILEDKKAKNETQHIASGKDFILK
ITEGLIREKTTYDGKPALLFIVRVRGPLAVNIPNKAFKILSLLRLVETNT
GVFVKLTKNVYPLLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGENEAE
PHEIVLNDNNIVEEQLGDHGIICVEDIIHEIATMGESFSVCNFFLQPFKL
NREVSGFGSLNRLRKIKQREAESRTRQFSNAATAPVIEVDIDSLLAKLN
3D structure
PDB8v84 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.
Chaint
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna t K54 F55 R57 K2 F3 R5
BS02 rna t E59 L66 R70 R77 H92 I93 A94 K97 K132 R146 R148 G149 L151 V153 E170 T171 S278 F280 R292 F301 S302 N303 A304 E7 L14 R18 R25 H40 I41 A42 K45 K59 R73 R75 G76 L78 V80 E97 T98 S205 F207 R219 F228 S229 N230 A231
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000465 exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8v84, PDBe:8v84, PDBj:8v84
PDBsum8v84
PubMed38632236
UniProtP40693|RLP7_YEAST Ribosome biogenesis protein RLP7 (Gene Name=RLP7)

[Back to BioLiP]