Structure of PDB 8uu9 Chain t

Receptor sequence
>8uu9t (length=80) Species: 1642 (Listeria innocua) [Search protein sequence]
PNIKSAIKRVKTAETRNSRNASQRSAMRTAIKKFDEAAANNADNAKDLYV
EASKKLDSAVSKGLIHKNNAARNKSRLAAK
3D structure
PDB8uu9 Mechanistic insights into the alternative ribosome recycling by HflXr.
Chaint
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna t P2 N3 I4 K9 R10 R17 N18 N21 S23 R29 K33 K55 D58 S62 K63 H67 N69 R73 K75 S76 R77 P1 N2 I3 K8 R9 R16 N17 N20 S22 R28 K32 K54 D57 S61 K62 H66 N68 R72 K74 S75 R76
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8uu9, PDBe:8uu9, PDBj:8uu9
PDBsum8uu9
PubMed38407413
UniProtA0A660JML5

[Back to BioLiP]