Structure of PDB 8qbt Chain t

Receptor sequence

>8qbtt (length=119) Species: 679895 (Escherichia coli BW25113) [Search protein sequence]

ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRK
VCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGA
LDCSGVKDRKQARSKYGVK

3D structure

PDB

8qbt Novel arrest peptides induce ribosome stalling by short circuiting the ribosomal peptidyltransferase activity

Chain

Resolution

2.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	t	A2 N5 Q6 L7 R9 R12 A13 R14 S19 A26 C27 P28 Q29 R31 K43 K44 N46 S47 A48 L49 R50 K51 T58 Y66 G69 E70 R83 G84 R86 K88 D89 P91 R94 R110 K111 Q112 A113 R114 S115 K116 Y117 V119 K120	A1 N4 Q5 L6 R8 R11 A12 R13 S18 A25 C26 P27 Q28 R30 K42 K43 N45 S46 A47 L48 R49 K50 T57 Y65 G68 E69 R82 G83 R85 K87 D88 P90 R93 R109 K110 Q111 A112 R113 S114 K115 Y116 V118 K119

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

External links