Structure of PDB 8q5i Chain t

Receptor sequence

>8q5it (length=191) Species: 5476 (Candida albicans) [Search protein sequence]

AISKNLPLLNNHFRKHWQERVRVHFDQAGKKASRRQSRLRKAAKIAPRPI
DALRPVVRAPTVKYNRKVRAGRGFTLAELKAVGIAPKYARTIGISVDHRR
QNKSQETFDANVARLQEYKSKLVIFDKKTKASEVASFEQVDVSATFPVEQ
PAPESGLRAVEVPEQTAYRTLRLARNEKKYKGIREKRAKEK

3D structure

PDB

8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy

Chain

Resolution

2.45 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	t	I3 K5 L7 P8 L10 N11 N12 H13 F14 R15 K16 H17 W18 Q19 R23 Q28 A29 K31 K32 R35 R36 R39 R55 V58 R59 P61 T62 Y65 N66 K68 R70 G72 R73 K81 R91 D98 H99 R100 R101 S105 R170 R173 N177 K180 Y181 R185 K187 R188	I2 K4 L6 P7 L9 N10 N11 H12 F13 R14 K15 H16 W17 Q18 R22 Q27 A28 K30 K31 R34 R35 R38 R54 V57 R58 P60 T61 Y64 N65 K67 R69 G71 R72 K80 R90 D97 H98 R99 R100 S104 R169 R172 N176 K179 Y180 R184 K186 R187
BS02	rna	t	F26 D27 G30	F25 D26 G29

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum	8q5i
PubMed
UniProt	A0A8H6F5V7

[Back to BioLiP]