Structure of PDB 8ipx Chain t

Receptor sequence
>8ipxt (length=111) Species: 9606 (Homo sapiens) [Search protein sequence]
EQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYA
FVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFK
QPSYPSVKRYN
3D structure
PDB8ipx Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
Chaint
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna t H51 N54 R81 T82 S85 E113 R114 H127 R148 H12 N15 R42 T43 S46 E74 R75 H88 R109
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0009303 rRNA transcription
GO:0016072 rRNA metabolic process
GO:0065003 protein-containing complex assembly
Cellular Component
GO:0000794 condensed nuclear chromosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ipx, PDBe:8ipx, PDBj:8ipx
PDBsum8ipx
PubMed37491604
UniProtQ9BYG3|MK67I_HUMAN MKI67 FHA domain-interacting nucleolar phosphoprotein (Gene Name=NIFK)

[Back to BioLiP]