Structure of PDB 8ev3 Chain t

Receptor sequence
>8ev3t (length=183) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]
FKRAETFINNYRQRERERIRLNRSAKNKGDIFVPDETKLLFVIRIAGVKN
MPPKIRKVLRLLRLSRINNAVFVRNNKAVAQMLRIVEPYVMYGIPNLHSV
RELIYKRGFGKINGQRIALSDNALIEEALGKYDVISIEDIIHEIYNVGSH
FKEVTKFLWPFTLTPRKAGYCGEEINELIKKQV
3D structure
PDB8ev3 Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Chaint
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna t F51 K52 R53 F1 K2 R3
BS02 rna t E55 N59 Y61 Q63 R66 R68 I69 R70 R73 P103 R106 K107 V108 L111 P138 E5 N9 Y11 Q13 R16 R18 I19 R20 R23 P53 R56 K57 V58 L61 P88
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ev3, PDBe:8ev3, PDBj:8ev3
PDBsum8ev3
PubMed36423630
UniProtP17937|RL7A_SCHPO Large ribosomal subunit protein uL30A (Gene Name=rlp7)

[Back to BioLiP]