Structure of PDB 8bim Chain t

Receptor sequence
>8bimt (length=82) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGT
RLDLDRIAHWVGQGATISDRVAALIKEVNKAA
3D structure
PDB8bim Modulation of translational decoding by m 6 A modification of mRNA.
Chaint
Resolution2.04 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna t R5 L6 K12 K13 R14 F16 R25 R28 R31 R35 E47 R51 R70 R5 L6 K12 K13 R14 F16 R25 R28 R31 R35 E47 R51 R70
Gene Ontology
Molecular Function
GO:0000400 four-way junction DNA binding
GO:0003735 structural constituent of ribosome
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006259 DNA metabolic process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bim, PDBe:8bim, PDBj:8bim
PDBsum8bim
PubMed37553384
UniProtP0A7T3|RS16_ECOLI Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]