Structure of PDB 8b64 Chain t

Receptor sequence
>8b64t (length=43) Species: 1061 (Rhodobacter capsulatus) [Search protein sequence]
DPRRVFVAQGVFLFLLAVLIHLILLSTPAFNWLTVATAKHGYV
3D structure
PDB8b64 Cryo-EM structure of a monomeric RC-LH1-PufX supercomplex with high-carotenoid content from Rhodobacter capsulatus.
Chaint
Resolution2.589 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL t A28 H32 W43 A17 H21 W32
BS02 SPO t F17 Q20 F23 L24 L27 F6 Q9 F12 L13 L16
BS03 SPO t F25 H32 F14 H21
BS04 BCL t L27 A28 I31 H32 L35 F41 L16 A17 I20 H21 L24 F30
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8b64, PDBe:8b64, PDBj:8b64
PDBsum8b64
PubMed36738736
UniProtP02948|LHA1_RHOCA Light-harvesting protein B-870 alpha chain (Gene Name=pufA)

[Back to BioLiP]