Structure of PDB 8azw Chain t

Receptor sequence

>8azwt (length=172) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

KKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARY
TVRSFGIRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCF
GFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARVGIQH
RVTKDDAMKWFQVKYEGVILNK

3D structure

PDB

8azw Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.14 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	t	K5 N9 M11 R12 Q45 S46 V48 T72 R74 G137 R139 R142 R143 A148 R149 G151 I152 H154	K1 N5 M7 R8 Q41 S42 V44 T68 R70 G133 R135 R138 R139 A144 R145 G147 I148 H150
BS02	rna	t	K18 V20 N22 S24 S50 A52 R53 V56 F59 A68 Y70 R96 N97 E100 T101 G105 F106 G126 D128 Y130 R144 R149 R155	K14 V16 N18 S20 S46 A48 R49 V52 F55 A64 Y66 R92 N93 E96 T97 G101 F102 G122 D124 Y126 R140 R145 R151

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8azw, PDBe:8azw, PDBj:8azw
PDBsum	8azw
PubMed	37156858
UniProt	A0A1S3XAW1

[Back to BioLiP]