Structure of PDB 7v08 Chain t

Receptor sequence

>7v08t (length=287) Species: 1247190 (Saccharomyces cerevisiae BY4741)

NPEILLRKRRNADRTRIERQELAKKKREEQIKKKRSNKNKFVRAESIVAK
TLATSREKERIKRVSILEDKKAKNETQHIASGKDFILKITEGLIREKTTY
DGKPALLFIVRVRGPLAVNIPNKAFKILSLLRLVETNTGVFVKLTKNVYP
LLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGENEAEPHEIVLNDNNIV
EEQLGDHGIICVEDIIHEIATMGESFSVCNFFLQPFKLNREVSGFGSLNR
LRKIKQREAESRTRQFSNAATAPVIEVDIDSLLAKLN

3D structure

• PDB: 7v08 rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
• Chain: t
• Resolution: 2.36 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	t	R33 S278 G279 F280 G281 N284	R19 S243 G244 F245 G246 N249
BS02	rna	t	K54 F55 R57 K64 A152	K40 F41 R43 K50 A117
BS03	rna	t	K46 R49 E59 S60 L66 R70 R77 H92 I93 A94 K97 K132 R146 R148 G149 V153 I155 E170 T171 R275 S278 G279 F280 R292 N303 A304	K32 R35 E45 S46 L52 R56 R63 H78 I79 A80 K83 K97 R111 R113 G114 V118 I120 E135 T136 R240 S243 G244 F245 R257 N268 A269

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0042134 rRNA primary transcript binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000465 exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor

External links

• PDB: RCSB:7v08, PDBe:7v08, PDBj:7v08
• PDBsum: 7v08
• PubMed: 36864048
• UniProt: P40693|RLP7_YEAST Ribosome biogenesis protein RLP7 (Gene Name=RLP7)