Structure of PDB 7umh Chain t

Receptor sequence
>7umht (length=338) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
MQTYGNDTVQYEWWAGNARFADQSGLFIAAHVAQAALTAFWAGAFTLFEI
SRFDPTQAMGDQGLILLPHLATLGWGVGDGGQIVDTYPYFVIGSIHLIAS
AVLGAGALFHTLRAPADLSTLKGQGKKFHFTWENPQQLGIILGHHLLFLG
AGALLLAGKAMYWGGLYDATTQTVRLVSQPTLDPLVIYGYQTHFASISSL
EDLVGGHIFVGFLLIGGGIWHILVPPLGWAKKVLLFSGEAILSYSLGGIA
LAGFVAAYFCAVNTLAYPPEFYGPPLAIKLGIFPYFADTVELPMHAHTSR
AWLANAHFFLAFFFLQGHLWHALRALGFDFKRVEQAFD
3D structure
PDB7umh Energetic robustness to large scale structural fluctuations in a photosynthetic supercomplex.
Chaint
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA t K127 F128 H144 F148 K127 F128 H144 F148
BS02 CLA t I28 H31 F128 I141 H144 H145 F148 I28 H31 F128 I141 H144 H145 F148
BS03 CLA t G106 F109 H110 Q124 F128 G106 F109 H110 Q124 F128
BS04 CLA t T38 A42 L66 L70 H96 T38 A42 L66 L70 H96
BS05 CLA t L149 G152 A153 L156 L203 H207 A252 V255 F259 Y267 L149 G152 A153 L156 L203 H207 A252 V255 F259 Y267
BS06 CLA t W41 H69 G152 I249 A252 A256 Y267 L303 H307 L310 F314 W41 H69 G152 I249 A252 A256 Y267 L303 H307 L310 F314
BS07 CLA t N17 Q34 L37 L310 F314 N17 Q34 L37 L310 F314
BS08 CLA t F312 F313 Q316 L319 L323 F312 F313 Q316 L319 L323
BS09 CLA t N17 F20 F27 H31 Q34 W132 I141 H145 G238 I241 L242 S245 I249 N17 F20 F27 H31 Q34 W132 I141 H145 G238 I241 L242 S245 I249
BS10 CLA t L138 L142 H145 L149 L214 F236 I241 Y244 S245 L138 L142 H145 L149 L214 F236 I241 Y244 S245
BS11 CLA t M1 A15 N17 L242 L246 F313 F314 G317 W320 H321 R324 M1 A15 N17 L242 L246 F313 F314 G317 W320 H321 R324
BS12 CLA t W13 G16 N17 R19 F20 L26 A30 T111 W13 G16 N17 R19 F20 L26 A30 T111
BS13 CLA t Y188 Q191 F194 F209 V255 Y188 Q191 F194 F209 V255
BS14 CLA t W41 F45 R52 G63 I65 W302 W41 F45 R52 G63 I65 W302
BS15 CLA t L234 Y244 G247 L251 L315 H318 L319 A322 L234 Y244 G247 L251 L315 H318 L319 A322
BS16 CLA t L142 L146 L213 G217 W220 H221 P225 P226 A230 L142 L146 L213 G217 W220 H221 P225 P226 A230
BS17 CLA t I282 F283 P284 F312 I282 F283 P284 F312
BS18 CLA t R332 V333 A336 F337 R332 V333 A336 F337
BS19 CLA t G104 A105 L108 G104 A105 L108
Gene Ontology
Molecular Function
GO:0016168 chlorophyll binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0010106 cellular response to iron ion starvation
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0009521 photosystem
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7umh, PDBe:7umh, PDBj:7umh
PDBsum7umh
PubMed37532717
UniProtQ55274|ISIA_SYNY3 Iron stress-induced chlorophyll-binding protein (Gene Name=isiA)

[Back to BioLiP]