Structure of PDB 7pjt Chain t

Receptor sequence
>7pjtt (length=85) Species: 562 (Escherichia coli) [Search protein sequence]
NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFN
EMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA
3D structure
PDB7pjt Structural mechanism of GTPase-powered ribosome-tRNA movement.
Chaint
Resolution6.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna t N2 I3 K4 K8 R9 K15 R17 N20 S25 T29 K32 K33 Y35 Q54 R59 K63 L65 H67 K68 K70 R73 A76 Q81 N1 I2 K3 K7 R8 K14 R16 N19 S24 T28 K31 K32 Y34 Q53 R58 K62 L64 H66 K67 K69 R72 A75 Q80
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pjt, PDBe:7pjt, PDBj:7pjt
PDBsum7pjt
PubMed34635670
UniProtC3TRH7

[Back to BioLiP]