Structure of PDB 7p7t Chain t

Receptor sequence

>7p7tt (length=82) Species: 1351 (Enterococcus faecalis) [Search protein sequence]

GRSLKKGPFVDDHLMKKVEAQQGAEKKKVIKTWSRRSTIFPSFVGFTIAV
YDGRKHVPVYIQEDMVGHKLGEFAPTRTYRGH

3D structure

PDB

7p7t Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	t	G2 R3 S4 L5 K6 K7 F10 H14 K18 W34 R36 R37 Y52 G54 R55 K70 G72 E73 T77 R78 T79 Y80 H83	G1 R2 S3 L4 K5 K6 F9 H13 K17 W33 R35 R36 Y51 G53 R54 K69 G71 E72 T76 R77 T78 Y79 H82

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links